PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C009552P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family M-type_MADS
Protein Properties Length: 387aa    MW: 43207 Da    PI: 4.3517
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C009552P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF32.51.1e-101151343
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                    i ++  r+ +f kRr g+lKK +EL +LC++ +  +i +++
  MELO3C009552P1 11 IASDNARKASFKKRRLGLLKKVSELTTLCGVYAFAVINGPD 51
                    678889*************************9999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-15160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.325147IPR002100Transcription factor, MADS-box
CDDcd002661.37E-25285No hitNo description
SuperFamilySSF554558.89E-19294IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-5323IPR002100Transcription factor, MADS-box
PfamPF003199.2E-121151IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-52338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MTRKKVKLVW IASDNARKAS FKKRRLGLLK KVSELTTLCG VYAFAVINGP DEDHPVIWPS  60
LSAAQHLYRR FHSLPEVERQ KKMTNQETYL KERTTKTQDL LKKHIKKNQE LELDLLMHQL  120
HQGRQIYQLT NGELLGLFWM IEERIRDCRK RIEYHHQVHR LPPPGLVTSN SPLLETENNE  180
IDLIDNGRNL MDQWFIDMVM NTNDKIGGSS SSMAGELGFV QAEGNGVDLM NGGGSSMVEV  240
SEIGGTGTII VEGDGEENNL LSEWNFGGND DSGMSEIEKL VNDIGGVGGH VELNASSMDL  300
SHEQGDFGIN CNVVGGPMGS VYTDGVEVND DAEMMLHGLY ENGISGEENV NQNGNDQNEL  360
EEDDEVEDED DEDDLLSKEW SNNFTP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLVWIASDNARKASFKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008442937.10.0PREDICTED: uncharacterized protein LOC103486691
TrEMBLA0A0A0LB390.0A0A0A0LB39_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110141938
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.12e-37AGAMOUS-like 48